HPA027225

STXBP3 antibody from Sigma-Aldrich
UNC-18C
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027225
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027225, RRID:AB_1857627
Product name
Anti-STXBP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027225
Antibody type
Polyclonal
Antigen
Syntaxin-binding protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FDDCKKEGEWKIMLLDEFTTKLLASCCKMTDLLEE
GITVVENIYKNREPVRQMKALYFITPTSKSVDCFL
HDFASKSENKYKAAYIYFTDFCPDNLF
Storage
-20C
Provider Type Product Number
- No reagents -