HPA019123

QKI antibody from Sigma-Aldrich
QK3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019123
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019123, RRID:AB_1855980
Product name
Anti-QKI antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019123
Antibody type
Polyclonal
Antigen
Protein quaking recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMEL
AILNGTYRDANIKSPALAFSLAATAQAAPRIITGP
APVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGT
PHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILE
YPIEPSGVL
Storage
-20C
Provider Type Product Number
- No reagents -