HPA007603

RIOX2 antibody from Atlas Antibodies
FLJ14393, JMJD10, mdig, MINA, MINA53, NO52
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007603
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007603, RRID:AB_1853957
Product name
Anti-RIOX2
Provider product page
Atlas Antibodies - HPA007603
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNF
DSPSSLFESLISPIKTETFFKEFWEQKPLLIQRDD
PALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRC
VNGKKKVLNKDGKAHFLQLRKDFDQKRATIQFHQP
QRFKDELW
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -