HPA014677

SFT2D1 antibody from Sigma-Aldrich
C6orf83, MGC19825, pRGR1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014677
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014677, RRID:AB_2238986
Product name
Anti-SFT2D1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014677
Antibody type
Polyclonal
Antigen
Vesicle transport protein SFT2A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRL
Storage
-20C
Provider Type Product Number
- No reagents -