HPA012115

PHYHD1 antibody from MilliporeSigma / Merck KGaA
MGC16638
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012115
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA012115, RRID:AB_1859448
Product name
Anti-PHYHD1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA012115
Antibody type
Polyclonal
Antigen
Phytanoyl-CoA dioxygenase domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLEGFLSAEECVAMQQRIGEIVAEMDVPLHCRTEF
STQEEEQLRAQGSTDYFLSSGDKIRFFFEKGVFDE
KGNFLVPPEKSINKIGHALHAHDPVFKSITHSFKV
QTLARSLGLQMPVVV
Storage
-20C
Provider Type Product Number
- No reagents -