HPA012115

PHYHD1 antibody from Atlas Antibodies
MGC16638
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012115
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012115, RRID:AB_1859448
Product name
Anti-PHYHD1
Provider product page
Atlas Antibodies - HPA012115
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VLEGFLSAEECVAMQQRIGEIVAEMDVPLHCRTEF
STQEEEQLRAQGSTDYFLSSGDKIRFFFEKGVFDE
KGNFLVPPEKSINKIGHALHAHDPVFKSITHSFKV
QTLARSLGLQMPVVV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -