HPA028392

PSMA5 antibody from Sigma-Aldrich
ZETA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028392
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028392, RRID:AB_10600115
Product name
Anti-PSMA5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028392
Antibody type
Polyclonal
Antigen
proteasome (prosome, macropain) subunit, alpha type, 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAV
EKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADA
KTLIDK
Storage
-20C
Provider Type Product Number
- No reagents -