HPA027985

TTLL2 antibody from Sigma-Aldrich
C6orf104, dJ366N23.3, NYD-TSPG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027985
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027985, RRID:AB_2211832
Product name
Anti-TTLL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027985
Antibody type
Polyclonal
Antigen
Probable tubulin polyglutamylase TTLL2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QSKPKLRSRHTPHKTLMPYASLFQSHSCKTKTSPC
VLSDRGKAPDPQAGNFVLVFPFNEATLGASRNGLN
VKR
Storage
-20C
Provider Type Product Number
- No reagents -