HPA027028

CYB561D1 antibody from Atlas Antibodies
FLJ39035, FLJ44753
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027028
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027028, RRID:AB_1847365
Product name
Anti-CYB561D1
Provider product page
Atlas Antibodies - HPA027028
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MEDRSEGGRARWVMPEIPALWEADAGGSLEVFSPG
TLYSWPWRSASAWLKPSYSSHLNTPCSSSAPEKHG
SGSTGQGRP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -