HPA007199

P4HTM antibody from Atlas Antibodies
EGLN4, FLJ20262, HIFPH4, P4H-TM, PH-4, PH4, PHD4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007199
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007199, RRID:AB_1235174
Product name
Anti-P4HTM
Provider product page
Atlas Antibodies - HPA007199
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KADPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESS
ELVRNSHHTWLYQGEGAHHIMRAIRQRVLRLTRLS
PEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETI
CSHTKLVANESVPFETSCRQVSPNWGLPSILRPGT
P
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -