HPA007199

P4HTM antibody from Sigma-Aldrich
EGLN4, FLJ20262, HIFPH4, P4H-TM, PH-4, PH4, PHD4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007199
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007199, RRID:AB_1855272
Product name
Anti-P4HTM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007199
Antibody type
Polyclonal
Antigen
Putative HIF-prolyl hydroxylase PH-4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KADPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESS
ELVRNSHHTWLYQGEGAHHIMRAIRQRVLRLTRLS
PEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETI
CSHTKLVANESVPFETSCRQVSPNWGLPSILRPGT
P
Storage
-20C
Provider Type Product Number
- No reagents -