HPA021593

PECR antibody from Atlas Antibodies
HSA250303, SDR29C1, TERP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021593
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021593, RRID:AB_1855177
Product name
Anti-PECR
Provider product page
Atlas Antibodies - HPA021593
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQKI
PAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDG
GRSLYTHSYEVPDHDNWPKGAGDLSVVKKMKETFK
EKAKL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -