H00055825-M02A

PECR antibody from Abnova Corporation
HSA250303, SDR29C1, TERP
No application information provided.

Antibody data

Product number
H00055825-M02A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055825-M02A, RRID:AB_1237812
Product name
PECR monoclonal antibody (M02A), clone 2F10
Provider product page
Abnova Corporation - H00055825-M02A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PECR.
Antigen sequence
MASWAKGRSYLAPGLLQGQVAIVTGGATGIGKAIV
KELLELGSNVVIASRKLERLKSAADELQANLPPTK
QARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLV
NNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCK
AVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAAR
AGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAV
ENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCF
LLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNW
PKGAGDLSVVKKMKETFKEKAKL
Isotype
IgM
Antibody clone number
2F10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -