HPA021593

PECR antibody from Sigma-Aldrich
HSA250303, SDR29C1, TERP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021593
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021593, RRID:AB_1855177
Product name
Anti-PECR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021593
Antibody type
Polyclonal
Antigen
Peroxisomal trans-2-enoyl-CoA reductase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQKI
PAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDG
GRSLYTHSYEVPDHDNWPKGAGDLSVVKKMKETFK
EKAKL
Storage
-20C
Provider Type Product Number
- No reagents -