SAB2101260

KIF25 antibody from Sigma-Aldrich
KNSL3
No application information provided.

Antibody data

Product number
SAB2101260
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2101260, RRID:AB_10610434
Product name
Anti-KIF25 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2101260
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_005346.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TWTSGQLQREKQARPGSGAVLAFPDDKDLRVYGPA
ESQSAVFGDVCPLLT
Storage
-20C
Provider Type Product Number
- No reagents -