HPA007200

MPI antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007200
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007200, RRID:AB_1854079
Product name
Anti-MPI antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007200
Antibody type
Polyclonal
Antigen
Mannose-6-phosphate isomerase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPR
GDAKILDNRISQKTLSQWIAENQDSLGSKVKDTFN
GNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAP
QHYPDANHKPEMAIALTPFQGLCG
Storage
-20C
Provider Type Product Number
- No reagents -