Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001435-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001435-M01, RRID:AB_463869
- Product name
- CSF1 monoclonal antibody (M01), clone 1A9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CSF1.
- Antigen sequence
EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITF
EFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDN
TPNAIAIVQLQELSLRLKSCFTKDYEEHDK- Isotype
- IgG
- Antibody clone number
- 1A9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references miR148b is a major coordinator of breast cancer progression in a relapse-associated microRNA signature by targeting ITGA5, ROCK1, PIK3CA, NRAS, and CSF1.
Pathway-based biomarker search by high-throughput proteomics profiling of secretomes.
Cimino D, De Pittà C, Orso F, Zampini M, Casara S, Penna E, Quaglino E, Forni M, Damasco C, Pinatel E, Ponzone R, Romualdi C, Brisken C, De Bortoli M, Biglia N, Provero P, Lanfranchi G, Taverna D
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2013 Mar;27(3):1223-35
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2013 Mar;27(3):1223-35
Pathway-based biomarker search by high-throughput proteomics profiling of secretomes.
Lawlor K, Nazarian A, Lacomis L, Tempst P, Villanueva J
Journal of proteome research 2009 Mar;8(3):1489-503
Journal of proteome research 2009 Mar;8(3):1489-503
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CSF1 expression in transfected 293T cell line by CSF1 monoclonal antibody (M01), clone 1A9.Lane 1: CSF1 transfected lysate(60.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CSF1 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol