Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310590 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Colony Stimulating Factor 1 (Macrophage) (CSF1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the N terminal of human CSF1
- Description
- Affinity Purified
- Reactivity
- Human, Rat
- Host
- Rabbit
- Antigen sequence
PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGS
GHLQS LQRLIDSQME- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A landscape effect in tenosynovial giant-cell tumor from activation of CSF1 expression by a translocation in a minority of tumor cells.
West RB, Rubin BP, Miller MA, Subramanian S, Kaygusuz G, Montgomery K, Zhu S, Marinelli RJ, De Luca A, Downs-Kelly E, Goldblum JR, Corless CL, Brown PO, Gilks CB, Nielsen TO, Huntsman D, van de Rijn M
Proceedings of the National Academy of Sciences of the United States of America 2006 Jan 17;103(3):690-5
Proceedings of the National Academy of Sciences of the United States of America 2006 Jan 17;103(3):690-5
No comments: Submit comment
No validations: Submit validation data