HPA010831

PHF2 antibody from Atlas Antibodies
CENP-35, JHDM1E, KDM7C, KIAA0662

Antibody data

Product number
HPA010831
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010831, RRID:AB_1855294
Product name
Anti-PHF2
Provider product page
Atlas Antibodies - HPA010831
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LEIREQTKSKSEAKWKYKNSKPDSLLKMEEEQKLE
KSPLAGNKDNKFSFSFSNKKLLGSKALRPPTSPGV
FGALQNFKEDKPKPVRDEYEYVSDDGELKIDEFPI
RRKKNAPKRDLSFLLDKKAVLPTPVTKPKLD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.