HPA010831

PHF2 antibody from Sigma-Aldrich
CENP-35, JHDM1E, KIAA0662
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010831
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010831, RRID:AB_1855294
Product name
Anti-PHF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010831
Antibody type
Polyclonal
Antigen
PHD finger protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEIREQTKSKSEAKWKYKNSKPDSLLKMEEEQKLE
KSPLAGNKDNKFSFSFSNKKLLGSKALRPPTSPGV
FGALQNFKEDKPKPVRDEYEYVSDDGELKIDEFPI
RRKKNAPKRDLSFLLDKKAVLPTPVTKPKLD
Storage
-20C
Provider Type Product Number
- No reagents -