Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405837 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-delta-Like 1 (DLL1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DLL1 antibody: synthetic peptide directed towards the N terminal of human DLL1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKK
GLLGN RNCCRGGAGP- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references 17β-estradiol enhances signalling mediated by VEGF-A-delta-like ligand 4-notch1 axis in human endothelial cells.
Conditionally reprogrammed cells represent a stem-like state of adult epithelial cells.
Delta-like protein (DLK) is a novel immunohistochemical marker for human hepatoblastomas.
Caliceti C, Aquila G, Pannella M, Morelli MB, Fortini C, Pinton P, Bonora M, Hrelia S, Pannuti A, Miele L, Rizzo P, Ferrari R
PloS one 2013;8(8):e71440
PloS one 2013;8(8):e71440
Conditionally reprogrammed cells represent a stem-like state of adult epithelial cells.
Suprynowicz FA, Upadhyay G, Krawczyk E, Kramer SC, Hebert JD, Liu X, Yuan H, Cheluvaraju C, Clapp PW, Boucher RC Jr, Kamonjoh CM, Randell SH, Schlegel R
Proceedings of the National Academy of Sciences of the United States of America 2012 Dec 4;109(49):20035-40
Proceedings of the National Academy of Sciences of the United States of America 2012 Dec 4;109(49):20035-40
Delta-like protein (DLK) is a novel immunohistochemical marker for human hepatoblastomas.
Dezso K, Halász J, Bisgaard HC, Paku S, Turányi E, Schaff Z, Nagy P
Virchows Archiv : an international journal of pathology 2008 Apr;452(4):443-8
Virchows Archiv : an international journal of pathology 2008 Apr;452(4):443-8
No comments: Submit comment
No validations: Submit validation data