HPA030085

PROK1 antibody from MilliporeSigma / Merck KGaA
EGVEGF, PK1, PRK1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030085
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030085, RRID:AB_10601153
Product name
Anti-PROK1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030085
Antibody type
Polyclonal
Antigen
prokineticin 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVP
FFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNI
N
Storage
-20C
Provider Type Product Number
- No reagents -