ABIN630070

antibody from antibodies-online

Targeting: KCNA10 Kv1.8

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN630070 - Provider product page
Provider: antibodies-online
Product name: anti-Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 10 (KCNA10) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: KCNA10 antibody was raised using the middle region of KCNA10 corresponding to a region with amino acids PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFW
Description: Purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Epitope: Middle Region
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

KCNA10 protein structure - ABIN630070 shown in red.