Antibody data

Product number
ABIN501379
Provider
antibodies-online
Product name
anti-Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 10 (KCNA10) antibody
Provider product page
antibodies-online - ABIN501379
Antibody type
Polyclonal
Antigen
The immunogen for anti-KCNA10 antibody: synthetic peptide directed towards the N terminal of human KCNA10
Reactivity
Human, Mouse, Rat
Host
Rabbit
Antigen sequence
DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTS
PKGRP GGSSFSNGKI
Vial size
50 µg
Provider Type Product Number
- No reagents -