Antibody data

Product number
ABIN183141
Provider
antibodies-online
Product name
anti-Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 10 (KCNA10) antibody
Provider product page
antibodies-online - ABIN183141
Antibody type
Polyclonal
Antigen
The immunogen for anti-KCNA10 antibody: synthetic peptide directed towards the middle region of human KCNA10
Reactivity
Human, Mouse, Rat, Chicken/Avian
Host
Rabbit
Antigen sequence
PANVPIDIFADEISFYELGSEAMDQFREDEGFIKD
PETLL PTNDIHRQFW
Vial size
0.1 mg
Provider Type Product Number
- No reagents -