AV35178

KCNA10 antibody from MilliporeSigma / Merck KGaA
Kv1.8
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV35178
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV35178, RRID:AB_1855572
Product name
Anti-KCNA10 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV35178
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human KCNA10 with an internal ID of P06413
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
REDEGFIKDPETLLPTNDIHRQFWLLFEYPESSSA
ARAVAVVSVLVVVIS
Storage
-20C
Provider Type Product Number
- No reagents -