HPA015061

KCNA10 antibody from Sigma-Aldrich
Kv1.8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015061
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015061, RRID:AB_1855573
Product name
Anti-KCNA10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015061
Antibody type
Polyclonal
Antigen
Potassium voltage-gated channel subfamily A member 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTS
PKGRPGGSSFSNGKILISESTNHETAFSKLPGDYA
DPPGPEPVVLNEGNQRVIINIAGLRFETQL
Storage
-20C
Provider Type Product Number
- No reagents -