PAB19993

RTL10 antibody from Abnova Corporation
BOP, C22orf29, FLJ21125

Antibody data

Product number
PAB19993
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB19993, RRID:AB_10966111
Product name
C22orf29 polyclonal antibody
Provider product page
Abnova Corporation - PAB19993
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant C22orf29.
Antigen sequence
TCGGKPAERGPLAGHMPSSRPHRVDFCWVPGSDPG
TFDGSPWLLDRFLAQLGDYMSFHFEHYQDNISRVC
EILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDL
KEVVQDPNSFAEYHAVVTCP
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -