HPA007891

LPCAT2 antibody from Sigma-Aldrich
AGPAT11, AYTL1, FLJ20481, LysoPAFAT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007891
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007891, RRID:AB_1845223
Product name
Anti-AYTL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007891
Antibody type
Polyclonal
Antigen
Lysophosphatidylcholine acyltransferase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FALFDRNHDGSIDFREYVIGLAVLCNPSNTEEIIQ
VAFKLFDVDEDGYITEEEFSTILQASLGVPDLDVS
GLFKEIAQGDSISYEEFKSFALKHPEYAKIFTTYL
DLQTCHVFSLPKEVQTTPSTASNKVSPE
Storage
-20C
Provider Type Product Number
- No reagents -