HPA008434

CCM2L antibody from Sigma-Aldrich
C20orf160, dJ310O13.5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008434
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008434, RRID:AB_1845671
Product name
Anti-C20orf160 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008434
Antibody type
Polyclonal
Antigen
Uncharacterized protein C20orf160 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IRRLVFPKAGRRAACRSSVSRRPLHSMPLYPPDYL
IDPQILLCDYLEKEVKFLGHLTWVTSSLNPSSRDE
LLQLLDTARQLKELPLKTTAEQDSILSLSARCLLL
TWRDNEELILRIPTHE
Storage
-20C
Provider Type Product Number
- No reagents -