Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023295-M07 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023295-M07, RRID:AB_581725
- Product name
- MGRN1 monoclonal antibody (M07), clone 3E1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MGRN1.
- Antigen sequence
PPPLGGAELALRESSSPESFITEEVDESSSPQQGT
RAASIENVLQDSSPEHCGRGPPADIYLPGRPTSME
TAHGLATTSPTWPPLGGPSPDPSAAELTPL- Isotype
- IgG
- Antibody clone number
- 3E1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MGRN1 expression in transfected 293T cell line by MGRN1 monoclonal antibody (M07), clone 3E1.Lane 1: MGRN1 transfected lysate(63.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to MGRN1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol