HPA007653

MGRN1 antibody from Sigma-Aldrich
KIAA0544, RNF156
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007653
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007653, RRID:AB_1846304
Product name
Anti-MGRN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007653
Antibody type
Polyclonal
Antigen
Probable E3 ubiquitin-protein ligase MGRN1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPFRALLQIRAVRKKPGALSPVSFSPVLAQSLEHD
EHSNSDSVPPGYEPISLLEALNGLRAVSPAIPSAP
LYEEITYSGISDGLSQASCPLAAIDHILDSSRQKG
RPQSKAPDSTLRSPSSPIHEEDE
Storage
-20C
Provider Type Product Number
- No reagents -