Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00080777-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00080777-B01P, RRID:AB_1673312
- Product name
- CYB5B purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human CYB5B protein.
- Antigen sequence
MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLK
ELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDA
SESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESG
SKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYT
SESKSS- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CYB5B expression in transfected 293T cell line (H00080777-T02) by CYB5B MaxPab polyclonal antibody.Lane 1: CYB5-M transfected lysate(16.06 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CYB5-M MaxPab polyclonal antibody. Western Blot analysis of CYB5-M expression in human liver.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CYB5B MaxPab polyclonal antibody. Western Blot analysis of CYB5B expression in Jurkat.