ABIN633651

antibody from antibodies-online

Targeting: ASIC4 ACCN4, BNAC4

Western blot

Antibody data

Submit

Validation data

Product number: ABIN633651 - Provider product page
Provider: antibodies-online
Product name: anti-Amiloride-Sensitive Cation Channel 4, Pituitary (ACCN4) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: ACCN4 antibody was raised using the middle region of ACCN4 corresponding to a region with amino acids NLTRYGKEISMVRIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTS
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

ASIC4 protein structure - ABIN633651 shown in red.