ABIN630651

antibody from antibodies-online

Targeting: HIPK1 KIAA0630, MGC26642, MGC33446, MGC33548, Myak, Nbak2

Western blot

Antibody data

Submit

Validation data

Product number: ABIN630651 - Provider product page
Provider: antibodies-online
Product name: anti-Homeodomain Interacting Protein Kinase 1 (HIPK1) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: HIPK1 antibody was raised using the middle region of HIPK1 corresponding to a region with amino acids PLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHS
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

HIPK1 protein structure - ABIN630651 shown in red.