H00204851-M07
antibody from Abnova Corporation
Targeting: HIPK1
KIAA0630, MGC26642, MGC33446, MGC33548, Myak, Nbak2
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00204851-M07 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00204851-M07, RRID:AB_606384
- Product name
- HIPK1 monoclonal antibody (M07), clone 4E1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HIPK1.
- Antigen sequence
CTPLMVATLHPQVATITPQYAVPFTLSCAAGRPAL
VEQTAAVLQAWPGGTQQILLPSTWQQLPGVALHNS
VQPTAMIPEAMGSGQQLADWRNAHSHGNQYS- Isotype
- IgG
- Antibody clone number
- 4E1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HIPK1 monoclonal antibody (M07), clone 4E1 Western Blot analysis of HIPK1 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HIPK1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to HIPK1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol