HPA016664

HIPK1 antibody from Sigma-Aldrich
KIAA0630, MGC26642, MGC33446, MGC33548, Myak, Nbak2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016664
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016664, RRID:AB_1850725
Product name
Anti-HIPK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016664
Antibody type
Polyclonal
Antigen
Homeodomain-interacting protein kinase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MASQLQVFSPPSVSSSAFCSAKKLKIEPSGWDVSG
QSSNDKYYTHSKTLPATQGQANSSHQVANFNIPAY
DQGLLLPAPAVEHIVVTAADSSGSAATSTFQSSQT
LTHRSNVSLLEPYQKCGLKRKSEEVDSNGSVQ
Storage
-20C
Provider Type Product Number
- No reagents -