ABIN970994

KANSL1 antibody from antibodies-online
CENP-36, DKFZP727C091, KIAA1267, MSL1v1, NSL1

Antibody data

Product number
ABIN970994
Provider
antibodies-online
Product name
anti-KAT8 Regulatory NSL Complex Subunit 1 (KANSL1) (N-Term) antibody
Provider product page
antibodies-online - ABIN970994
Antibody type
Polyclonal
Antigen
Other
Reactivity
Human
Host
Rabbit
Antigen sequence
QPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLT
KSSTH SDHDNSTSLN
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -