HPA006874

KANSL1 antibody from Sigma-Aldrich
CENP-36, DKFZP727C091, KIAA1267, MSL1v1, NSL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006874
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006874, RRID:AB_1852393
Product name
Anti-KIAA1267 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006874
Antibody type
Polyclonal
Antigen
Uncharacterized protein KIAA1267 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
APLLERLSQLDSCVHPVLAFPDDVPTSLHFQSMLK
SQWQNKPFDKIKPPKKLSLKHRAPMPGSLPDSARK
DRHKLVSSFLTTAKLSHHQTRPDRTHRQHLDDVGA
VPMVERVTAPKAERLLNPPPPVHDPNHSKMRLRDH
SS
Storage
-20C
Provider Type Product Number
- No reagents -