HPA018846

CSDE1 antibody from Atlas Antibodies
D1S155E, UNR
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018846
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018846, RRID:AB_1847266
Product name
Anti-CSDE1
Provider product page
Atlas Antibodies - HPA018846
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFI
QCSERQARLFFHCSQYNGNLQDLKVGDDVEFEVSS
DRRTGKPIAVKLVKIKQEILPEERMNGQEVFYLTY
TPEDVEGNVQLETGDKIN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -