HPA021083

SYCP1 antibody from Atlas Antibodies
CT8, HOM-TES-14, SCP1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021083
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021083, RRID:AB_1857685
Product name
Anti-SYCP1
Provider product page
Atlas Antibodies - HPA021083
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TLGGDSTFFKSFNKCTEDDFEFPFAKTNLSKNGEN
IDSDPALQKVNFLPVLEQVGNSDCHYQEGLKDSDL
ENSEGLSRVYSKLYKEAEKIKKWKVSTEAELRQKE
SKLQENRKIIEAQRKAIQEL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -