HPA012845

MMP19 antibody from Sigma-Aldrich
MMP18, RASI-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012845
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012845, RRID:AB_1854027
Product name
Anti-MMP19 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012845
Antibody type
Polyclonal
Antigen
Matrix metalloproteinase-19 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVY
EGYRPHFKLHPDDVAGIQALYGKKSPVIRDEEEEE
TELPTVPPVPTEPSPMPDPCSSELDAMMLGPRGKT
YAFKGDYVWTVSD
Storage
-20C
Provider Type Product Number
- No reagents -