HPA025235

VANGL1 antibody from Atlas Antibodies
STB2
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA025235
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA025235, RRID:AB_1858718
Product name
Anti-VANGL1
Provider product page
Atlas Antibodies - HPA025235
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRN
KDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQDDN
WGETTTAITGTSEHSISQEDIARISKDMEDSVGLD
CKRY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -