Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA025235 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA025235, RRID:AB_1858718
- Product name
- Anti-VANGL1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRN
KDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQDDN
WGETTTAITGTSEHSISQEDIARISKDMEDSVGLD
CKRY- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Flattop regulates basal body docking and positioning in mono- and multiciliated cells.
Planar cell polarity effector gene Intu regulates cell fate-specific differentiation of keratinocytes through the primary cilia.
Postnatal refinement of auditory hair cell planar polarity deficits occurs in the absence of Vangl2.
Gegg M, Böttcher A, Burtscher I, Hasenoeder S, Van Campenhout C, Aichler M, Walch A, Grant SG, Lickert H
eLife 2014 Oct 8;3
eLife 2014 Oct 8;3
Planar cell polarity effector gene Intu regulates cell fate-specific differentiation of keratinocytes through the primary cilia.
Dai D, Li L, Huebner A, Zeng H, Guevara E, Claypool DJ, Liu A, Chen J
Cell death and differentiation 2013 Jan;20(1):130-8
Cell death and differentiation 2013 Jan;20(1):130-8
Postnatal refinement of auditory hair cell planar polarity deficits occurs in the absence of Vangl2.
Copley CO, Duncan JS, Liu C, Cheng H, Deans MR
The Journal of neuroscience : the official journal of the Society for Neuroscience 2013 Aug 28;33(35):14001-16
The Journal of neuroscience : the official journal of the Society for Neuroscience 2013 Aug 28;33(35):14001-16
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-VANGL1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and VANGL1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403377).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of MCF7 cells shows localization to plasma membrane.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows strong positivity in apical membrane in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows moderate membranous positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
- Sample type
- HUMAN