HPA027285

CASQ2 antibody from Sigma-Aldrich
PDIB2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027285
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027285, RRID:AB_1845933
Product name
Anti-CASQ2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027285
Antibody type
Polyclonal
Antigen
Calsequestrin-2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCL
YYHEPVSSDKVTQKQFQLKEIVLELVAQVL
Storage
-20C
Provider Type Product Number
- No reagents -