HPA008436

HJURP antibody from Sigma-Aldrich
DKFZp762E1312, FAKTS, hFLEG1, URLC9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008436
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008436, RRID:AB_1850757
Product name
Anti-HJURP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008436
Antibody type
Polyclonal
Antigen
Holliday junction recognition protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TPVVQMATLTYETPQGLRIWGGRLIKERNEGEIQD
SSMKPADRTDGSVQAAAWGPELPSHRTVLGADSKS
GEVDATSDQEESVAWALAPAVPQSPLKNELRRKYL
TQVDILLQGAEYFECAGNRAGRDVRV
Storage
-20C
Provider Type Product Number
- No reagents -