HPA017384

SP100 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017384
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017384, RRID:AB_1857399
Product name
Anti-SP100 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017384
Antibody type
Polyclonal
Antigen
Nuclear autoantigen Sp-100 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YKGFENVIHDKLPLQESEEEEREERSGLQLSLEQG
TGENSFRSLTWPPSGSPSHAGTTPPENGLSEHPCE
TEQINAKRKDTTSDKDDSLGSQQTNEQCAQKAEPT
ESCEQIAVQVNNGDAGREMPCPL
Storage
-20C
Provider Type Product Number
- No reagents -