Antibody data

Product number
HPA017384
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017384, RRID:AB_1857399
Product name
Anti-SP100
Provider product page
Atlas Antibodies - HPA017384
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YKGFENVIHDKLPLQESEEEEREERSGLQLSLEQG
TGENSFRSLTWPPSGSPSHAGTTPPENGLSEHPCE
TEQINAKRKDTTSDKDDSLGSQQTNEQCAQKAEPT
ESCEQIAVQVNNGDAGREMPCPL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.