HPA001168

JOSD1 antibody from Sigma-Aldrich
KIAA0063
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001168
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001168, RRID:AB_1079162
Product name
Anti-JOSD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001168
Antibody type
Polyclonal
Antigen
Josephin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VFQDSNAFTRDTLQEIFQRLSPNTMVTPHKKSMLG
NGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALT
NVMGFIMNLPSSLCWGPLKLPLKRQHWICVREVGG
AYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCE
LLLVV
Storage
-20C
Provider Type Product Number
- No reagents -