ABIN405413

POSTN antibody from antibodies-online
OSF-2, periostin, PN
Western blot
Recommended by provider
Immunohistochemistry
Data presented on provider website

Antibody data

Product number
ABIN405413
Provider
antibodies-online
Product name
anti-Periostin, Osteoblast Specific Factor (POSTN) (Middle Region) antibody
Provider product page
antibodies-online - ABIN405413
Antibody type
Polyclonal
Antigen
The immunogen for anti-POSTN antibody: synthetic peptide directed towards the middle region of human POSTN
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
Host
Rabbit
Antigen sequence
VTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANK
KVQGS RRRLREGRSQ
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -