HPA012306

POSTN antibody from Sigma-Aldrich
OSF-2, periostin, PN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012306
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012306, RRID:AB_1854827
Product name
Anti-POSTN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012306
Antibody type
Polyclonal
Antigen
Periostin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GLFINHYPNGVVTVNCARIIHGNQIATNGVVHVID
RVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEA
LGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVAS
EALMKYHILNTLQCSESIMGGAVFETLEG
Storage
-20C
Provider Type Product Number
- No reagents -